Anti ERCC5 pAb (ATL-HPA050374)

Atlas Antibodies

Catalog No.:
ATL-HPA050374-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ERCC excision repair 5, endonuclease
Gene Name: ERCC5
Alternative Gene Name: ERCM2, XPGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026048: 43%, ENSRNOG00000022812: 44%
Entrez Gene ID: 2073
Uniprot ID: P28715
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKRKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVK
Gene Sequence EKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKRKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVK
Gene ID - Mouse ENSMUSG00000026048
Gene ID - Rat ENSRNOG00000022812
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ERCC5 pAb (ATL-HPA050374)
Datasheet Anti ERCC5 pAb (ATL-HPA050374) Datasheet (External Link)
Vendor Page Anti ERCC5 pAb (ATL-HPA050374) at Atlas Antibodies

Documents & Links for Anti ERCC5 pAb (ATL-HPA050374)
Datasheet Anti ERCC5 pAb (ATL-HPA050374) Datasheet (External Link)
Vendor Page Anti ERCC5 pAb (ATL-HPA050374)