Anti ERCC2 pAb (ATL-HPA069266)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069266-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ERCC2
Alternative Gene Name: EM9, MAG, MGC102762, MGC126218, MGC126219, TFIIH, XPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030400: 94%, ENSRNOG00000017753: 95%
Entrez Gene ID: 2068
Uniprot ID: P18074
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLK |
Gene Sequence | QEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLK |
Gene ID - Mouse | ENSMUSG00000030400 |
Gene ID - Rat | ENSRNOG00000017753 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ERCC2 pAb (ATL-HPA069266) | |
Datasheet | Anti ERCC2 pAb (ATL-HPA069266) Datasheet (External Link) |
Vendor Page | Anti ERCC2 pAb (ATL-HPA069266) at Atlas Antibodies |
Documents & Links for Anti ERCC2 pAb (ATL-HPA069266) | |
Datasheet | Anti ERCC2 pAb (ATL-HPA069266) Datasheet (External Link) |
Vendor Page | Anti ERCC2 pAb (ATL-HPA069266) |