Anti ERCC2 pAb (ATL-HPA038057)

Atlas Antibodies

Catalog No.:
ATL-HPA038057-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: excision repair cross-complementation group 2
Gene Name: ERCC2
Alternative Gene Name: EM9, MAG, MGC102762, MGC126218, MGC126219, TFIIH, XPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030400: 97%, ENSRNOG00000017753: 98%
Entrez Gene ID: 2068
Uniprot ID: P18074
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFL
Gene Sequence AHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFL
Gene ID - Mouse ENSMUSG00000030400
Gene ID - Rat ENSRNOG00000017753
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ERCC2 pAb (ATL-HPA038057)
Datasheet Anti ERCC2 pAb (ATL-HPA038057) Datasheet (External Link)
Vendor Page Anti ERCC2 pAb (ATL-HPA038057) at Atlas Antibodies

Documents & Links for Anti ERCC2 pAb (ATL-HPA038057)
Datasheet Anti ERCC2 pAb (ATL-HPA038057) Datasheet (External Link)
Vendor Page Anti ERCC2 pAb (ATL-HPA038057)