Anti ERBB2 pAb (ATL-HPA001383)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001383-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: ERBB2
Alternative Gene Name: CD340, HER-2, HER2, NEU, NGL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062312: 82%, ENSRNOG00000006450: 81%
Entrez Gene ID: 2064
Uniprot ID: P04626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA |
| Gene Sequence | LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA |
| Gene ID - Mouse | ENSMUSG00000062312 |
| Gene ID - Rat | ENSRNOG00000006450 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ERBB2 pAb (ATL-HPA001383) | |
| Datasheet | Anti ERBB2 pAb (ATL-HPA001383) Datasheet (External Link) |
| Vendor Page | Anti ERBB2 pAb (ATL-HPA001383) at Atlas Antibodies |
| Documents & Links for Anti ERBB2 pAb (ATL-HPA001383) | |
| Datasheet | Anti ERBB2 pAb (ATL-HPA001383) Datasheet (External Link) |
| Vendor Page | Anti ERBB2 pAb (ATL-HPA001383) |
| Citations for Anti ERBB2 pAb (ATL-HPA001383) – 9 Found |
| Seigel, G M; Sharma, S; Hackam, A S; Shah, Dhaval K. HER2/ERBB2 immunoreactivity in human retinoblastoma. Tumour Biology : The Journal Of The International Society For Oncodevelopmental Biology And Medicine. 2016;37(5):6135-42. PubMed |
| Sousa, David Cordeiro; Zoroquiain, Pablo; Orellana, Maria Eugenia; Dias, Ana Beatriz; Esposito, Evangelina; Burnier, Miguel N Jr. HER2 Overexpression in Retinoblastoma: A Potential Therapeutic Target?. Ocular Oncology And Pathology. 2017;3(3):210-215. PubMed |
| Kristensen, Lotte K; Christensen, Camilla; Jensen, Mette M; Agnew, Brian J; Schjöth-Frydendahl, Christina; Kjaer, Andreas; Nielsen, Carsten H. Site-specifically labeled (89)Zr-DFO-trastuzumab improves immuno-reactivity and tumor uptake for immuno-PET in a subcutaneous HER2-positive xenograft mouse model. Theranostics. 9(15):4409-4420. PubMed |
| Donovan, Laura K; Delaidelli, Alberto; Joseph, Sujith K; Bielamowicz, Kevin; Fousek, Kristen; Holgado, Borja L; Manno, Alex; Srikanthan, Dilakshan; Gad, Ahmed Z; Van Ommeren, Randy; Przelicki, David; Richman, Cory; Ramaswamy, Vijay; Daniels, Craig; Pallota, Jonelle G; Douglas, Tajana; Joynt, Alyssa C M; Haapasalo, Joonas; Nor, Carolina; Vladoiu, Maria C; Kuzan-Fischer, Claudia M; Garzia, Livia; Mack, Stephen C; Varadharajan, Srinidhi; Baker, Matthew L; Hendrikse, Liam; Ly, Michelle; Kharas, Kaitlin; Balin, Polina; Wu, Xiaochong; Qin, Lei; Huang, Ning; Stucklin, Ana Guerreiro; Morrissy, A Sorana; Cavalli, Florence M G; Luu, Betty; Suarez, Raul; De Antonellis, Pasqualino; Michealraj, Antony; Rastan, Avesta; Hegde, Meenakshi; Komosa, Martin; Sirbu, Olga; Kumar, Sachin A; Abdullaev, Zied; Faria, Claudia C; Yip, Stephen; Hukin, Juliette; Tabori, Uri; Hawkins, Cynthia; Aldape, Ken; Daugaard, Mads; Maris, John M; Sorensen, Poul H; Ahmed, Nabil; Taylor, Michael D. Locoregional delivery of CAR T cells to the cerebrospinal fluid for treatment of metastatic medulloblastoma and ependymoma. Nature Medicine. 2020;26(5):720-731. PubMed |
| Huvila, Jutta; Talve, Lauri; Carpén, Olli; Edqvist, Per-Henrik; Pontén, Fredrik; Grénman, Seija; Auranen, Annika. Progesterone receptor negativity is an independent risk factor for relapse in patients with early stage endometrioid endometrial adenocarcinoma. Gynecologic Oncology. 2013;130(3):463-9. PubMed |
| Newie, Inga; Søkilde, Rolf; Persson, Helena; Grabau, Dorthe; Rego, Natalia; Kvist, Anders; von Stedingk, Kristoffer; Axelson, Håkan; Borg, Åke; Vallon-Christersson, Johan; Rovira, Carlos. The HER2-encoded miR-4728-3p regulates ESR1 through a non-canonical internal seed interaction. Plos One. 9(5):e97200. PubMed |
| Xie, Zu-Cheng; Tang, Rui-Xue; Gao, Xiang; Xie, Qiong-Ni; Lin, Jia-Ying; Chen, Gang; Li, Zu-Yun. A meta-analysis and bioinformatics exploration of the diagnostic value and molecular mechanism of miR-193a-5p in lung cancer. Oncology Letters. 2018;16(4):4114-4128. PubMed |
| Seigel, Gail M; Shah, Dhaval K; Mendoza, Pia; Szalai, Ezster; Grossniklaus, Hans; Song, Yinghui; Shan, Jidong. In situ analysis of Her2 DNA and RNA in retinoblastoma and adjacent retina. Oncoscience. 2019;6(7-8):357-366. PubMed |
| Georgiou-Siafis, Sofia K; Miliotou, Androulla N; Ntenti, Charikleia; Pappas, Ioannis S; Papadopoulou, Lefkothea C. An Innovative PTD-IVT-mRNA Delivery Platform for CAR Immunotherapy of ErbB(+) Solid Tumor Neoplastic Cells. Biomedicines. 2022;10(11) PubMed |