Anti ERAP1 pAb (ATL-HPA042317)

Atlas Antibodies

SKU:
ATL-HPA042317-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: endoplasmic reticulum aminopeptidase 1
Gene Name: ERAP1
Alternative Gene Name: A-LAP, ARTS-1, ERAAP1, KIAA0525, PILS-AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021583: 87%, ENSRNOG00000009997: 88%
Entrez Gene ID: 51752
Uniprot ID: Q9NZ08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLS
Gene Sequence FQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLS
Gene ID - Mouse ENSMUSG00000021583
Gene ID - Rat ENSRNOG00000009997
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ERAP1 pAb (ATL-HPA042317)
Datasheet Anti ERAP1 pAb (ATL-HPA042317) Datasheet (External Link)
Vendor Page Anti ERAP1 pAb (ATL-HPA042317) at Atlas Antibodies

Documents & Links for Anti ERAP1 pAb (ATL-HPA042317)
Datasheet Anti ERAP1 pAb (ATL-HPA042317) Datasheet (External Link)
Vendor Page Anti ERAP1 pAb (ATL-HPA042317)