Anti ERAP1 pAb (ATL-HPA042317)

Atlas Antibodies

Catalog No.: ATL-HPA042317-25

Protein Description: endoplasmic reticulum aminopeptidase 1
Gene Name: ERAP1
Alternative Gene Name: A-LAP, ARTS-1, ERAAP1, KIAA0525, PILS-AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021583: 87%, ENSRNOG00000009997: 88%
Entrez Gene ID: 51752
Uniprot ID: Q9NZ08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLS
• Gene Sequence: FQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLS
• Gene ID - Mouse: ENSMUSG00000021583
• Gene ID - Rat: ENSRNOG00000009997
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.