Anti EPYC pAb (ATL-HPA045455)

Atlas Antibodies

Catalog No.:
ATL-HPA045455-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: epiphycan
Gene Name: EPYC
Alternative Gene Name: DSPG3, Pg-Lb, SLRR3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019936: 55%, ENSRNOG00000004717: 55%
Entrez Gene ID: 1833
Uniprot ID: Q99645
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTLESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIATVMPSGNRELLTPPPQPEKAQEEEEE
Gene Sequence PTLESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIATVMPSGNRELLTPPPQPEKAQEEEEE
Gene ID - Mouse ENSMUSG00000019936
Gene ID - Rat ENSRNOG00000004717
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPYC pAb (ATL-HPA045455)
Datasheet Anti EPYC pAb (ATL-HPA045455) Datasheet (External Link)
Vendor Page Anti EPYC pAb (ATL-HPA045455) at Atlas Antibodies

Documents & Links for Anti EPYC pAb (ATL-HPA045455)
Datasheet Anti EPYC pAb (ATL-HPA045455) Datasheet (External Link)
Vendor Page Anti EPYC pAb (ATL-HPA045455)