Anti EPX pAb (ATL-HPA050507)

Atlas Antibodies

Catalog No.:
ATL-HPA050507-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: eosinophil peroxidase
Gene Name: EPX
Alternative Gene Name: EPO, EPP, EPX-PEN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052234: 84%, ENSRNOG00000008707: 78%
Entrez Gene ID: 8288
Uniprot ID: P11678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKS
Gene Sequence EGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKS
Gene ID - Mouse ENSMUSG00000052234
Gene ID - Rat ENSRNOG00000008707
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPX pAb (ATL-HPA050507)
Datasheet Anti EPX pAb (ATL-HPA050507) Datasheet (External Link)
Vendor Page Anti EPX pAb (ATL-HPA050507) at Atlas Antibodies

Documents & Links for Anti EPX pAb (ATL-HPA050507)
Datasheet Anti EPX pAb (ATL-HPA050507) Datasheet (External Link)
Vendor Page Anti EPX pAb (ATL-HPA050507)
Citations for Anti EPX pAb (ATL-HPA050507) – 1 Found
Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094.  PubMed