Anti EPX pAb (ATL-HPA050507)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050507-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EPX
Alternative Gene Name: EPO, EPP, EPX-PEN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052234: 84%, ENSRNOG00000008707: 78%
Entrez Gene ID: 8288
Uniprot ID: P11678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKS |
| Gene Sequence | EGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKS |
| Gene ID - Mouse | ENSMUSG00000052234 |
| Gene ID - Rat | ENSRNOG00000008707 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EPX pAb (ATL-HPA050507) | |
| Datasheet | Anti EPX pAb (ATL-HPA050507) Datasheet (External Link) |
| Vendor Page | Anti EPX pAb (ATL-HPA050507) at Atlas Antibodies |
| Documents & Links for Anti EPX pAb (ATL-HPA050507) | |
| Datasheet | Anti EPX pAb (ATL-HPA050507) Datasheet (External Link) |
| Vendor Page | Anti EPX pAb (ATL-HPA050507) |
| Citations for Anti EPX pAb (ATL-HPA050507) – 1 Found |
| Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094. PubMed |