Anti EPS8 pAb (ATL-HPA003897)

Atlas Antibodies

SKU:
ATL-HPA003897-25
  • Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: epidermal growth factor receptor pathway substrate 8
Gene Name: EPS8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015766: 80%, ENSRNOG00000007047: 80%
Entrez Gene ID: 2059
Uniprot ID: Q12929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEILDD
Gene Sequence PKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEILDD
Gene ID - Mouse ENSMUSG00000015766
Gene ID - Rat ENSRNOG00000007047
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EPS8 pAb (ATL-HPA003897)
Datasheet Anti EPS8 pAb (ATL-HPA003897) Datasheet (External Link)
Vendor Page Anti EPS8 pAb (ATL-HPA003897) at Atlas Antibodies

Documents & Links for Anti EPS8 pAb (ATL-HPA003897)
Datasheet Anti EPS8 pAb (ATL-HPA003897) Datasheet (External Link)
Vendor Page Anti EPS8 pAb (ATL-HPA003897)