Anti EPS15L1 pAb (ATL-HPA055309)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055309-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: EPS15L1
Alternative Gene Name: eps15R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006276: 88%, ENSRNOG00000013502: 86%
Entrez Gene ID: 58513
Uniprot ID: Q9UBC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDPFVPSSAAKPSKASASGFADFTS |
| Gene Sequence | PVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDPFVPSSAAKPSKASASGFADFTS |
| Gene ID - Mouse | ENSMUSG00000006276 |
| Gene ID - Rat | ENSRNOG00000013502 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EPS15L1 pAb (ATL-HPA055309) | |
| Datasheet | Anti EPS15L1 pAb (ATL-HPA055309) Datasheet (External Link) |
| Vendor Page | Anti EPS15L1 pAb (ATL-HPA055309) at Atlas Antibodies |
| Documents & Links for Anti EPS15L1 pAb (ATL-HPA055309) | |
| Datasheet | Anti EPS15L1 pAb (ATL-HPA055309) Datasheet (External Link) |
| Vendor Page | Anti EPS15L1 pAb (ATL-HPA055309) |