Anti EPS15L1 pAb (ATL-HPA055309)

Atlas Antibodies

Catalog No.: ATL-HPA055309-25

Protein Description: epidermal growth factor receptor pathway substrate 15-like 1
Gene Name: EPS15L1
Alternative Gene Name: eps15R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006276: 88%, ENSRNOG00000013502: 86%
Entrez Gene ID: 58513
Uniprot ID: Q9UBC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDPFVPSSAAKPSKASASGFADFTS
• Gene Sequence: PVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDPFVPSSAAKPSKASASGFADFTS
• Gene ID - Mouse: ENSMUSG00000006276
• Gene ID - Rat: ENSRNOG00000013502
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.