Anti EPS15L1 pAb (ATL-HPA055309)

Atlas Antibodies

Catalog No.:
ATL-HPA055309-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: epidermal growth factor receptor pathway substrate 15-like 1
Gene Name: EPS15L1
Alternative Gene Name: eps15R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006276: 88%, ENSRNOG00000013502: 86%
Entrez Gene ID: 58513
Uniprot ID: Q9UBC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDPFVPSSAAKPSKASASGFADFTS
Gene Sequence PVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDPFVPSSAAKPSKASASGFADFTS
Gene ID - Mouse ENSMUSG00000006276
Gene ID - Rat ENSRNOG00000013502
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPS15L1 pAb (ATL-HPA055309)
Datasheet Anti EPS15L1 pAb (ATL-HPA055309) Datasheet (External Link)
Vendor Page Anti EPS15L1 pAb (ATL-HPA055309) at Atlas Antibodies

Documents & Links for Anti EPS15L1 pAb (ATL-HPA055309)
Datasheet Anti EPS15L1 pAb (ATL-HPA055309) Datasheet (External Link)
Vendor Page Anti EPS15L1 pAb (ATL-HPA055309)