Anti EPS15L1 pAb (ATL-HPA055309)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055309-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EPS15L1
Alternative Gene Name: eps15R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006276: 88%, ENSRNOG00000013502: 86%
Entrez Gene ID: 58513
Uniprot ID: Q9UBC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDPFVPSSAAKPSKASASGFADFTS |
Gene Sequence | PVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDPFVPSSAAKPSKASASGFADFTS |
Gene ID - Mouse | ENSMUSG00000006276 |
Gene ID - Rat | ENSRNOG00000013502 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EPS15L1 pAb (ATL-HPA055309) | |
Datasheet | Anti EPS15L1 pAb (ATL-HPA055309) Datasheet (External Link) |
Vendor Page | Anti EPS15L1 pAb (ATL-HPA055309) at Atlas Antibodies |
Documents & Links for Anti EPS15L1 pAb (ATL-HPA055309) | |
Datasheet | Anti EPS15L1 pAb (ATL-HPA055309) Datasheet (External Link) |
Vendor Page | Anti EPS15L1 pAb (ATL-HPA055309) |