Anti EPS15 pAb (ATL-HPA061431)

Atlas Antibodies

SKU: ATL-HPA061431-25

• 

Protein Description: epidermal growth factor receptor pathway substrate 15
Gene Name: EPS15
Alternative Gene Name: AF-1P, MLLT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028552: 94%, ENSRNOG00000010299: 92%
Entrez Gene ID: 2060
Uniprot ID: P42566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL
• Gene Sequence: DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL
• Gene ID - Mouse: ENSMUSG00000028552
• Gene ID - Rat: ENSRNOG00000010299
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.