Anti EPS15 pAb (ATL-HPA061431)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061431-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: EPS15
Alternative Gene Name: AF-1P, MLLT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028552: 94%, ENSRNOG00000010299: 92%
Entrez Gene ID: 2060
Uniprot ID: P42566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL |
Gene Sequence | DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL |
Gene ID - Mouse | ENSMUSG00000028552 |
Gene ID - Rat | ENSRNOG00000010299 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EPS15 pAb (ATL-HPA061431) | |
Datasheet | Anti EPS15 pAb (ATL-HPA061431) Datasheet (External Link) |
Vendor Page | Anti EPS15 pAb (ATL-HPA061431) at Atlas Antibodies |
Documents & Links for Anti EPS15 pAb (ATL-HPA061431) | |
Datasheet | Anti EPS15 pAb (ATL-HPA061431) Datasheet (External Link) |
Vendor Page | Anti EPS15 pAb (ATL-HPA061431) |