Anti EPS15 pAb (ATL-HPA061431)

Atlas Antibodies

Catalog No.:
ATL-HPA061431-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: epidermal growth factor receptor pathway substrate 15
Gene Name: EPS15
Alternative Gene Name: AF-1P, MLLT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028552: 94%, ENSRNOG00000010299: 92%
Entrez Gene ID: 2060
Uniprot ID: P42566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL
Gene Sequence DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL
Gene ID - Mouse ENSMUSG00000028552
Gene ID - Rat ENSRNOG00000010299
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPS15 pAb (ATL-HPA061431)
Datasheet Anti EPS15 pAb (ATL-HPA061431) Datasheet (External Link)
Vendor Page Anti EPS15 pAb (ATL-HPA061431) at Atlas Antibodies

Documents & Links for Anti EPS15 pAb (ATL-HPA061431)
Datasheet Anti EPS15 pAb (ATL-HPA061431) Datasheet (External Link)
Vendor Page Anti EPS15 pAb (ATL-HPA061431)