Anti EPRS pAb (ATL-HPA030052 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA030052-25
  • Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Western blot analysis using Anti-EPRS antibody HPA030052 (A) shows similar pattern to independent antibody HPA026490 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glutamyl-prolyl-tRNA synthetase
Gene Name: EPRS
Alternative Gene Name: EARS, GLUPRORS, PARS, QARS, QPRS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026615: 88%, ENSRNOG00000002393: 89%
Entrez Gene ID: 2058
Uniprot ID: P07814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELA
Gene Sequence DWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELA
Gene ID - Mouse ENSMUSG00000026615
Gene ID - Rat ENSRNOG00000002393
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EPRS pAb (ATL-HPA030052 w/enhanced validation)
Datasheet Anti EPRS pAb (ATL-HPA030052 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EPRS pAb (ATL-HPA030052 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EPRS pAb (ATL-HPA030052 w/enhanced validation)
Datasheet Anti EPRS pAb (ATL-HPA030052 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EPRS pAb (ATL-HPA030052 w/enhanced validation)