Anti EPPIN-WFDC6 pAb (ATL-HPA067335)

Atlas Antibodies

Catalog No.:
ATL-HPA067335-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: EPPIN-WFDC6 readthrough
Gene Name: EPPIN-WFDC6
Alternative Gene Name: SPINLW1-WFDC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017733: 69%, ENSRNOG00000028908: 72%
Entrez Gene ID: 100526773
Uniprot ID: O95925
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQD
Gene Sequence GPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQD
Gene ID - Mouse ENSMUSG00000017733
Gene ID - Rat ENSRNOG00000028908
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPPIN-WFDC6 pAb (ATL-HPA067335)
Datasheet Anti EPPIN-WFDC6 pAb (ATL-HPA067335) Datasheet (External Link)
Vendor Page Anti EPPIN-WFDC6 pAb (ATL-HPA067335) at Atlas Antibodies

Documents & Links for Anti EPPIN-WFDC6 pAb (ATL-HPA067335)
Datasheet Anti EPPIN-WFDC6 pAb (ATL-HPA067335) Datasheet (External Link)
Vendor Page Anti EPPIN-WFDC6 pAb (ATL-HPA067335)