Anti EPOP pAb (ATL-HPA056555 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA056555-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: elongin BC and polycomb repressive complex 2 associated protein
Gene Name: EPOP
Alternative Gene Name: C17orf96, LOC100170841, PRR28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043439: 83%, ENSRNOG00000048187: 83%
Entrez Gene ID: 100170841
Uniprot ID: A6NHQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NCFPCPPALVVGEDGDLKPASSLRLQGDSK
Gene Sequence NCFPCPPALVVGEDGDLKPASSLRLQGDSK
Gene ID - Mouse ENSMUSG00000043439
Gene ID - Rat ENSRNOG00000048187
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPOP pAb (ATL-HPA056555 w/enhanced validation)
Datasheet Anti EPOP pAb (ATL-HPA056555 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EPOP pAb (ATL-HPA056555 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EPOP pAb (ATL-HPA056555 w/enhanced validation)
Datasheet Anti EPOP pAb (ATL-HPA056555 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EPOP pAb (ATL-HPA056555 w/enhanced validation)