Anti EPOP pAb (ATL-HPA056555 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056555-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EPOP
Alternative Gene Name: C17orf96, LOC100170841, PRR28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043439: 83%, ENSRNOG00000048187: 83%
Entrez Gene ID: 100170841
Uniprot ID: A6NHQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NCFPCPPALVVGEDGDLKPASSLRLQGDSK |
Gene Sequence | NCFPCPPALVVGEDGDLKPASSLRLQGDSK |
Gene ID - Mouse | ENSMUSG00000043439 |
Gene ID - Rat | ENSRNOG00000048187 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EPOP pAb (ATL-HPA056555 w/enhanced validation) | |
Datasheet | Anti EPOP pAb (ATL-HPA056555 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EPOP pAb (ATL-HPA056555 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti EPOP pAb (ATL-HPA056555 w/enhanced validation) | |
Datasheet | Anti EPOP pAb (ATL-HPA056555 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EPOP pAb (ATL-HPA056555 w/enhanced validation) |