Anti EPN3 pAb (ATL-HPA055546)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055546-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: EPN3
Alternative Gene Name: FLJ20778, MGC129899
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010080: 83%, ENSRNOG00000003284: 84%
Entrez Gene ID: 55040
Uniprot ID: Q9H201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SADPWDIPGFRPNTEASGSSWGPSADPWSPIPSGTVLSRSQPWDLTPMLSSSEPWGRTPVLPAGPPTTDPWALNSPHHKLPST |
| Gene Sequence | SADPWDIPGFRPNTEASGSSWGPSADPWSPIPSGTVLSRSQPWDLTPMLSSSEPWGRTPVLPAGPPTTDPWALNSPHHKLPST |
| Gene ID - Mouse | ENSMUSG00000010080 |
| Gene ID - Rat | ENSRNOG00000003284 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EPN3 pAb (ATL-HPA055546) | |
| Datasheet | Anti EPN3 pAb (ATL-HPA055546) Datasheet (External Link) |
| Vendor Page | Anti EPN3 pAb (ATL-HPA055546) at Atlas Antibodies |
| Documents & Links for Anti EPN3 pAb (ATL-HPA055546) | |
| Datasheet | Anti EPN3 pAb (ATL-HPA055546) Datasheet (External Link) |
| Vendor Page | Anti EPN3 pAb (ATL-HPA055546) |
| Citations for Anti EPN3 pAb (ATL-HPA055546) – 1 Found |
| Mori, Jinichi; Tanikawa, Chizu; Ohnishi, Naomi; Funauchi, Yuki; Toyoshima, Osamu; Ueda, Koji; Matsuda, Koichi. EPSIN 3, A Novel p53 Target, Regulates the Apoptotic Pathway and Gastric Carcinogenesis. Neoplasia (New York, N.y.). 2017;19(3):185-195. PubMed |