Anti EPN1 pAb (ATL-HPA071503)

Atlas Antibodies

Catalog No.:
ATL-HPA071503-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: epsin 1
Gene Name: EPN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035203: 89%, ENSRNOG00000015753: 86%
Entrez Gene ID: 29924
Uniprot ID: Q9Y6I3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPVSGPSASDPWTPAPAFSDPWGGSPAKPSTNGTTAAG
Gene Sequence PAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPVSGPSASDPWTPAPAFSDPWGGSPAKPSTNGTTAAG
Gene ID - Mouse ENSMUSG00000035203
Gene ID - Rat ENSRNOG00000015753
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPN1 pAb (ATL-HPA071503)
Datasheet Anti EPN1 pAb (ATL-HPA071503) Datasheet (External Link)
Vendor Page Anti EPN1 pAb (ATL-HPA071503) at Atlas Antibodies

Documents & Links for Anti EPN1 pAb (ATL-HPA071503)
Datasheet Anti EPN1 pAb (ATL-HPA071503) Datasheet (External Link)
Vendor Page Anti EPN1 pAb (ATL-HPA071503)