Anti EPN1 pAb (ATL-HPA071503)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071503-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EPN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035203: 89%, ENSRNOG00000015753: 86%
Entrez Gene ID: 29924
Uniprot ID: Q9Y6I3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPVSGPSASDPWTPAPAFSDPWGGSPAKPSTNGTTAAG |
Gene Sequence | PAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPVSGPSASDPWTPAPAFSDPWGGSPAKPSTNGTTAAG |
Gene ID - Mouse | ENSMUSG00000035203 |
Gene ID - Rat | ENSRNOG00000015753 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EPN1 pAb (ATL-HPA071503) | |
Datasheet | Anti EPN1 pAb (ATL-HPA071503) Datasheet (External Link) |
Vendor Page | Anti EPN1 pAb (ATL-HPA071503) at Atlas Antibodies |
Documents & Links for Anti EPN1 pAb (ATL-HPA071503) | |
Datasheet | Anti EPN1 pAb (ATL-HPA071503) Datasheet (External Link) |
Vendor Page | Anti EPN1 pAb (ATL-HPA071503) |