Anti EPHB3 pAb (ATL-HPA007698)

Atlas Antibodies

Catalog No.:
ATL-HPA007698-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: EPH receptor B3
Gene Name: EPHB3
Alternative Gene Name: ETK2, Hek2, Tyro6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005958: 96%, ENSRNOG00000031801: 97%
Entrez Gene ID: 2049
Uniprot ID: P54753
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AHTRYTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPNGVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEFETTSE
Gene Sequence AHTRYTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPNGVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEFETTSE
Gene ID - Mouse ENSMUSG00000005958
Gene ID - Rat ENSRNOG00000031801
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPHB3 pAb (ATL-HPA007698)
Datasheet Anti EPHB3 pAb (ATL-HPA007698) Datasheet (External Link)
Vendor Page Anti EPHB3 pAb (ATL-HPA007698) at Atlas Antibodies

Documents & Links for Anti EPHB3 pAb (ATL-HPA007698)
Datasheet Anti EPHB3 pAb (ATL-HPA007698) Datasheet (External Link)
Vendor Page Anti EPHB3 pAb (ATL-HPA007698)