Anti EPHB3 pAb (ATL-HPA007698)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007698-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EPHB3
Alternative Gene Name: ETK2, Hek2, Tyro6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005958: 96%, ENSRNOG00000031801: 97%
Entrez Gene ID: 2049
Uniprot ID: P54753
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AHTRYTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPNGVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEFETTSE |
| Gene Sequence | AHTRYTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPNGVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEFETTSE |
| Gene ID - Mouse | ENSMUSG00000005958 |
| Gene ID - Rat | ENSRNOG00000031801 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EPHB3 pAb (ATL-HPA007698) | |
| Datasheet | Anti EPHB3 pAb (ATL-HPA007698) Datasheet (External Link) |
| Vendor Page | Anti EPHB3 pAb (ATL-HPA007698) at Atlas Antibodies |
| Documents & Links for Anti EPHB3 pAb (ATL-HPA007698) | |
| Datasheet | Anti EPHB3 pAb (ATL-HPA007698) Datasheet (External Link) |
| Vendor Page | Anti EPHB3 pAb (ATL-HPA007698) |