Anti EPHB2 pAb (ATL-HPA071200)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071200-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: EPHB2
Alternative Gene Name: DRT, EPHT3, ERK, Hek5, Tyro5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028664: 100%, ENSRNOG00000012531: 100%
Entrez Gene ID: 2048
Uniprot ID: P29323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVI |
Gene Sequence | CRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVI |
Gene ID - Mouse | ENSMUSG00000028664 |
Gene ID - Rat | ENSRNOG00000012531 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EPHB2 pAb (ATL-HPA071200) | |
Datasheet | Anti EPHB2 pAb (ATL-HPA071200) Datasheet (External Link) |
Vendor Page | Anti EPHB2 pAb (ATL-HPA071200) at Atlas Antibodies |
Documents & Links for Anti EPHB2 pAb (ATL-HPA071200) | |
Datasheet | Anti EPHB2 pAb (ATL-HPA071200) Datasheet (External Link) |
Vendor Page | Anti EPHB2 pAb (ATL-HPA071200) |