Anti EPHB2 pAb (ATL-HPA071200)

Atlas Antibodies

Catalog No.:
ATL-HPA071200-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: EPH receptor B2
Gene Name: EPHB2
Alternative Gene Name: DRT, EPHT3, ERK, Hek5, Tyro5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028664: 100%, ENSRNOG00000012531: 100%
Entrez Gene ID: 2048
Uniprot ID: P29323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVI
Gene Sequence CRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVI
Gene ID - Mouse ENSMUSG00000028664
Gene ID - Rat ENSRNOG00000012531
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPHB2 pAb (ATL-HPA071200)
Datasheet Anti EPHB2 pAb (ATL-HPA071200) Datasheet (External Link)
Vendor Page Anti EPHB2 pAb (ATL-HPA071200) at Atlas Antibodies

Documents & Links for Anti EPHB2 pAb (ATL-HPA071200)
Datasheet Anti EPHB2 pAb (ATL-HPA071200) Datasheet (External Link)
Vendor Page Anti EPHB2 pAb (ATL-HPA071200)