Anti EPHA10 pAb (ATL-HPA027497)

Atlas Antibodies

Catalog No.:
ATL-HPA027497-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: EPH receptor A10
Gene Name: EPHA10
Alternative Gene Name: FLJ16103, FLJ33655
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028876: 94%, ENSRNOG00000037340: 93%
Entrez Gene ID: 284656
Uniprot ID: Q5JZY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPIPAGAPGANDTEYEIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAAS
Gene Sequence TTYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPIPAGAPGANDTEYEIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAAS
Gene ID - Mouse ENSMUSG00000028876
Gene ID - Rat ENSRNOG00000037340
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPHA10 pAb (ATL-HPA027497)
Datasheet Anti EPHA10 pAb (ATL-HPA027497) Datasheet (External Link)
Vendor Page Anti EPHA10 pAb (ATL-HPA027497) at Atlas Antibodies

Documents & Links for Anti EPHA10 pAb (ATL-HPA027497)
Datasheet Anti EPHA10 pAb (ATL-HPA027497) Datasheet (External Link)
Vendor Page Anti EPHA10 pAb (ATL-HPA027497)