Anti EPHA10 pAb (ATL-HPA027497)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027497-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EPHA10
Alternative Gene Name: FLJ16103, FLJ33655
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028876: 94%, ENSRNOG00000037340: 93%
Entrez Gene ID: 284656
Uniprot ID: Q5JZY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TTYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPIPAGAPGANDTEYEIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAAS |
| Gene Sequence | TTYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPIPAGAPGANDTEYEIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAAS |
| Gene ID - Mouse | ENSMUSG00000028876 |
| Gene ID - Rat | ENSRNOG00000037340 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EPHA10 pAb (ATL-HPA027497) | |
| Datasheet | Anti EPHA10 pAb (ATL-HPA027497) Datasheet (External Link) |
| Vendor Page | Anti EPHA10 pAb (ATL-HPA027497) at Atlas Antibodies |
| Documents & Links for Anti EPHA10 pAb (ATL-HPA027497) | |
| Datasheet | Anti EPHA10 pAb (ATL-HPA027497) Datasheet (External Link) |
| Vendor Page | Anti EPHA10 pAb (ATL-HPA027497) |