Anti EPGN pAb (ATL-HPA014369)

Atlas Antibodies

SKU:
ATL-HPA014369-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nuclear membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: epithelial mitogen
Gene Name: EPGN
Alternative Gene Name: ALGV3072, EPG, epigen, PRO9904
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035020: 83%, ENSRNOG00000002782: 80%
Entrez Gene ID: 255324
Uniprot ID: Q6UW88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYE
Gene Sequence ALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYE
Gene ID - Mouse ENSMUSG00000035020
Gene ID - Rat ENSRNOG00000002782
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EPGN pAb (ATL-HPA014369)
Datasheet Anti EPGN pAb (ATL-HPA014369) Datasheet (External Link)
Vendor Page Anti EPGN pAb (ATL-HPA014369) at Atlas Antibodies

Documents & Links for Anti EPGN pAb (ATL-HPA014369)
Datasheet Anti EPGN pAb (ATL-HPA014369) Datasheet (External Link)
Vendor Page Anti EPGN pAb (ATL-HPA014369)