Anti EPC2 pAb (ATL-HPA036759)

Atlas Antibodies

Catalog No.: ATL-HPA036759-25

Protein Description: enhancer of polycomb homolog 2 (Drosophila)
Gene Name: EPC2
Alternative Gene Name: DKFZP566F2124
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069495: 94%, ENSRNOG00000029447: 89%
Entrez Gene ID: 26122
Uniprot ID: Q52LR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YATPATLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQQPTPETLPVINKSDIKQYDFHSSDEDEFPQVLS
• Gene Sequence: YATPATLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQQPTPETLPVINKSDIKQYDFHSSDEDEFPQVLS
• Gene ID - Mouse: ENSMUSG00000069495
• Gene ID - Rat: ENSRNOG00000029447
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.