Anti EPC2 pAb (ATL-HPA036759)

Atlas Antibodies

Catalog No.:
ATL-HPA036759-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: enhancer of polycomb homolog 2 (Drosophila)
Gene Name: EPC2
Alternative Gene Name: DKFZP566F2124
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069495: 94%, ENSRNOG00000029447: 89%
Entrez Gene ID: 26122
Uniprot ID: Q52LR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YATPATLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQQPTPETLPVINKSDIKQYDFHSSDEDEFPQVLS
Gene Sequence YATPATLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQQPTPETLPVINKSDIKQYDFHSSDEDEFPQVLS
Gene ID - Mouse ENSMUSG00000069495
Gene ID - Rat ENSRNOG00000029447
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPC2 pAb (ATL-HPA036759)
Datasheet Anti EPC2 pAb (ATL-HPA036759) Datasheet (External Link)
Vendor Page Anti EPC2 pAb (ATL-HPA036759) at Atlas Antibodies

Documents & Links for Anti EPC2 pAb (ATL-HPA036759)
Datasheet Anti EPC2 pAb (ATL-HPA036759) Datasheet (External Link)
Vendor Page Anti EPC2 pAb (ATL-HPA036759)