Anti EPC1 pAb (ATL-HPA028931)

Atlas Antibodies

SKU:
ATL-HPA028931-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: enhancer of polycomb homolog 1
Gene Name: EPC1
Alternative Gene Name: Epl1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024240: 83%, ENSRNOG00000014834: 83%
Entrez Gene ID: 80314
Uniprot ID: Q9H2F5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DYDSVFHHLDLEMLSSPQHSPVNQFANTSETNTSDKSFSKDLSQILVNIKSCRWRHFRPRTPSLHDSDNDELSCRKLYRSINRTGTAQPGTQTCSTSTQSKSSSGSAHFAFTAEQYQQHQQQLALMQKQQLAQIQQQQA
Gene Sequence DYDSVFHHLDLEMLSSPQHSPVNQFANTSETNTSDKSFSKDLSQILVNIKSCRWRHFRPRTPSLHDSDNDELSCRKLYRSINRTGTAQPGTQTCSTSTQSKSSSGSAHFAFTAEQYQQHQQQLALMQKQQLAQIQQQQA
Gene ID - Mouse ENSMUSG00000024240
Gene ID - Rat ENSRNOG00000014834
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EPC1 pAb (ATL-HPA028931)
Datasheet Anti EPC1 pAb (ATL-HPA028931) Datasheet (External Link)
Vendor Page Anti EPC1 pAb (ATL-HPA028931) at Atlas Antibodies

Documents & Links for Anti EPC1 pAb (ATL-HPA028931)
Datasheet Anti EPC1 pAb (ATL-HPA028931) Datasheet (External Link)
Vendor Page Anti EPC1 pAb (ATL-HPA028931)