Anti EPB42 pAb (ATL-HPA040261)

Atlas Antibodies

Catalog No.: ATL-HPA040261-25

Protein Description: erythrocyte membrane protein band 4.2
Gene Name: EPB42
Alternative Gene Name: MGC116735, MGC116737, PA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023216: 64%, ENSRNOG00000011649: 68%
Entrez Gene ID: 2038
Uniprot ID: P16452
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVT
• Gene Sequence: FAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVT
• Gene ID - Mouse: ENSMUSG00000023216
• Gene ID - Rat: ENSRNOG00000011649
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EPB42 pAb (ATL-HPA040261) – 1 Found

Uzozie, Anuli; Nanni, Paolo; Staiano, Teresa; Grossmann, Jonas; Barkow-Oesterreicher, Simon; Shay, Jerry W; Tiwari, Amit; Buffoli, Federico; Laczko, Endre; Marra, Giancarlo. Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study. Molecular & Cellular Proteomics : Mcp. 2014;13(5):1198-218.