Anti EPB42 pAb (ATL-HPA040261)

Atlas Antibodies

Catalog No.:
ATL-HPA040261-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: erythrocyte membrane protein band 4.2
Gene Name: EPB42
Alternative Gene Name: MGC116735, MGC116737, PA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023216: 64%, ENSRNOG00000011649: 68%
Entrez Gene ID: 2038
Uniprot ID: P16452
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVT
Gene Sequence FAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVT
Gene ID - Mouse ENSMUSG00000023216
Gene ID - Rat ENSRNOG00000011649
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPB42 pAb (ATL-HPA040261)
Datasheet Anti EPB42 pAb (ATL-HPA040261) Datasheet (External Link)
Vendor Page Anti EPB42 pAb (ATL-HPA040261) at Atlas Antibodies

Documents & Links for Anti EPB42 pAb (ATL-HPA040261)
Datasheet Anti EPB42 pAb (ATL-HPA040261) Datasheet (External Link)
Vendor Page Anti EPB42 pAb (ATL-HPA040261)
Citations for Anti EPB42 pAb (ATL-HPA040261) – 1 Found
Uzozie, Anuli; Nanni, Paolo; Staiano, Teresa; Grossmann, Jonas; Barkow-Oesterreicher, Simon; Shay, Jerry W; Tiwari, Amit; Buffoli, Federico; Laczko, Endre; Marra, Giancarlo. Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study. Molecular & Cellular Proteomics : Mcp. 2014;13(5):1198-218.  PubMed