Anti EPB41L1 pAb (ATL-HPA054104 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054104-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: EPB41L1
Alternative Gene Name: KIAA0338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027624: 88%, ENSRNOG00000057817: 88%
Entrez Gene ID: 2036
Uniprot ID: Q9H4G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPE |
| Gene Sequence | EAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPE |
| Gene ID - Mouse | ENSMUSG00000027624 |
| Gene ID - Rat | ENSRNOG00000057817 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EPB41L1 pAb (ATL-HPA054104 w/enhanced validation) | |
| Datasheet | Anti EPB41L1 pAb (ATL-HPA054104 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EPB41L1 pAb (ATL-HPA054104 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti EPB41L1 pAb (ATL-HPA054104 w/enhanced validation) | |
| Datasheet | Anti EPB41L1 pAb (ATL-HPA054104 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EPB41L1 pAb (ATL-HPA054104 w/enhanced validation) |
| Citations for Anti EPB41L1 pAb (ATL-HPA054104 w/enhanced validation) – 1 Found |
| Liang, Taotao; Sang, Siyao; Shao, Qi; Chen, Chen; Deng, Zhichao; Wang, Ting; Kang, Qiaozhen. Abnormal expression and prognostic significance of EPB41L1 in kidney renal clear cell carcinoma based on data mining. Cancer Cell International. 20( 32760223):356. PubMed |