Anti EPAS1 pAb (ATL-HPA031200)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031200-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: EPAS1
Alternative Gene Name: bHLHe73, HIF2A, HLF, MOP2, PASD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024140: 95%, ENSRNOG00000021318: 93%
Entrez Gene ID: 2034
Uniprot ID: Q99814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG |
| Gene Sequence | GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG |
| Gene ID - Mouse | ENSMUSG00000024140 |
| Gene ID - Rat | ENSRNOG00000021318 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EPAS1 pAb (ATL-HPA031200) | |
| Datasheet | Anti EPAS1 pAb (ATL-HPA031200) Datasheet (External Link) |
| Vendor Page | Anti EPAS1 pAb (ATL-HPA031200) at Atlas Antibodies |
| Documents & Links for Anti EPAS1 pAb (ATL-HPA031200) | |
| Datasheet | Anti EPAS1 pAb (ATL-HPA031200) Datasheet (External Link) |
| Vendor Page | Anti EPAS1 pAb (ATL-HPA031200) |