Anti EPAS1 pAb (ATL-HPA031200)

Atlas Antibodies

Catalog No.:
ATL-HPA031200-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: endothelial PAS domain protein 1
Gene Name: EPAS1
Alternative Gene Name: bHLHe73, HIF2A, HLF, MOP2, PASD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024140: 95%, ENSRNOG00000021318: 93%
Entrez Gene ID: 2034
Uniprot ID: Q99814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG
Gene Sequence GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG
Gene ID - Mouse ENSMUSG00000024140
Gene ID - Rat ENSRNOG00000021318
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPAS1 pAb (ATL-HPA031200)
Datasheet Anti EPAS1 pAb (ATL-HPA031200) Datasheet (External Link)
Vendor Page Anti EPAS1 pAb (ATL-HPA031200) at Atlas Antibodies

Documents & Links for Anti EPAS1 pAb (ATL-HPA031200)
Datasheet Anti EPAS1 pAb (ATL-HPA031200) Datasheet (External Link)
Vendor Page Anti EPAS1 pAb (ATL-HPA031200)