Anti EPAS1 pAb (ATL-HPA031200)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031200-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: EPAS1
Alternative Gene Name: bHLHe73, HIF2A, HLF, MOP2, PASD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024140: 95%, ENSRNOG00000021318: 93%
Entrez Gene ID: 2034
Uniprot ID: Q99814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG |
Gene Sequence | GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG |
Gene ID - Mouse | ENSMUSG00000024140 |
Gene ID - Rat | ENSRNOG00000021318 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EPAS1 pAb (ATL-HPA031200) | |
Datasheet | Anti EPAS1 pAb (ATL-HPA031200) Datasheet (External Link) |
Vendor Page | Anti EPAS1 pAb (ATL-HPA031200) at Atlas Antibodies |
Documents & Links for Anti EPAS1 pAb (ATL-HPA031200) | |
Datasheet | Anti EPAS1 pAb (ATL-HPA031200) Datasheet (External Link) |
Vendor Page | Anti EPAS1 pAb (ATL-HPA031200) |