Anti ENTPD7 pAb (ATL-HPA014351)

Atlas Antibodies

Catalog No.:
ATL-HPA014351-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ectonucleoside triphosphate diphosphohydrolase 7
Gene Name: ENTPD7
Alternative Gene Name: FLJ30978, LALP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025192: 90%, ENSRNOG00000016883: 92%
Entrez Gene ID: 57089
Uniprot ID: Q9NQZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGLTDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNSEF
Gene Sequence YEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGLTDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNSEF
Gene ID - Mouse ENSMUSG00000025192
Gene ID - Rat ENSRNOG00000016883
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ENTPD7 pAb (ATL-HPA014351)
Datasheet Anti ENTPD7 pAb (ATL-HPA014351) Datasheet (External Link)
Vendor Page Anti ENTPD7 pAb (ATL-HPA014351) at Atlas Antibodies

Documents & Links for Anti ENTPD7 pAb (ATL-HPA014351)
Datasheet Anti ENTPD7 pAb (ATL-HPA014351) Datasheet (External Link)
Vendor Page Anti ENTPD7 pAb (ATL-HPA014351)