Anti ENTPD4 pAb (ATL-HPA017655)

Atlas Antibodies

SKU: ATL-HPA017655-25

• 
• 
• 

Protein Description: ectonucleoside triphosphate diphosphohydrolase 4
Gene Name: ENTPD4
Alternative Gene Name: KIAA0392, LALP70, LAP70, LYSAL1, NTPDase-4, UDPase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022066: 93%, ENSRNOG00000016321: 93%
Entrez Gene ID: 9583
Uniprot ID: Q9Y227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FGGNAARQRYEDRIFANTIQKNRLLGKQTGLTPDMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFSEFYYCTEDVLR
• Gene Sequence: FGGNAARQRYEDRIFANTIQKNRLLGKQTGLTPDMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFSEFYYCTEDVLR
• Gene ID - Mouse: ENSMUSG00000022066
• Gene ID - Rat: ENSRNOG00000016321
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.