Anti ENPP2 pAb (ATL-HPA053652)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053652-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ENPP2
Alternative Gene Name: ATX, PD-IALPHA, PDNP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022425: 94%, ENSRNOG00000004089: 92%
Entrez Gene ID: 5168
Uniprot ID: Q13822
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLT |
| Gene Sequence | TNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLT |
| Gene ID - Mouse | ENSMUSG00000022425 |
| Gene ID - Rat | ENSRNOG00000004089 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ENPP2 pAb (ATL-HPA053652) | |
| Datasheet | Anti ENPP2 pAb (ATL-HPA053652) Datasheet (External Link) |
| Vendor Page | Anti ENPP2 pAb (ATL-HPA053652) at Atlas Antibodies |
| Documents & Links for Anti ENPP2 pAb (ATL-HPA053652) | |
| Datasheet | Anti ENPP2 pAb (ATL-HPA053652) Datasheet (External Link) |
| Vendor Page | Anti ENPP2 pAb (ATL-HPA053652) |
| Citations for Anti ENPP2 pAb (ATL-HPA053652) – 1 Found |
| Lind, Anne-Li; Just, David; Mikus, Maria; Fredolini, Claudia; Ioannou, Marina; Gerdle, Björn; Ghafouri, Bijar; Bäckryd, Emmanuel; Tanum, Lars; Gordh, Torsten; Månberg, Anna. CSF levels of apolipoprotein C1 and autotaxin found to associate with neuropathic pain and fibromyalgia. Journal Of Pain Research. 12( 31686904):2875-2889. PubMed |