Anti ENPP2 pAb (ATL-HPA053652)

Atlas Antibodies

Catalog No.: ATL-HPA053652-25

Protein Description: ectonucleotide pyrophosphatase/phosphodiesterase 2
Gene Name: ENPP2
Alternative Gene Name: ATX, PD-IALPHA, PDNP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022425: 94%, ENSRNOG00000004089: 92%
Entrez Gene ID: 5168
Uniprot ID: Q13822
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLT
• Gene Sequence: TNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLT
• Gene ID - Mouse: ENSMUSG00000022425
• Gene ID - Rat: ENSRNOG00000004089
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ENPP2 pAb (ATL-HPA053652) – 1 Found

Lind, Anne-Li; Just, David; Mikus, Maria; Fredolini, Claudia; Ioannou, Marina; Gerdle, Björn; Ghafouri, Bijar; Bäckryd, Emmanuel; Tanum, Lars; Gordh, Torsten; Månberg, Anna. CSF levels of apolipoprotein C1 and autotaxin found to associate with neuropathic pain and fibromyalgia. Journal Of Pain Research. 12( 31686904):2875-2889.