Anti ENPP1 pAb (ATL-HPA062066)

Atlas Antibodies

Catalog No.: ATL-HPA062066-25

Protein Description: ectonucleotide pyrophosphatase/phosphodiesterase 1
Gene Name: ENPP1
Alternative Gene Name: M6S1, NPPS, PC-1, PCA1, PDNP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037370: 91%, ENSRNOG00000013994: 91%
Entrez Gene ID: 5167
Uniprot ID: P22413
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC
• Gene Sequence: GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC
• Gene ID - Mouse: ENSMUSG00000037370
• Gene ID - Rat: ENSRNOG00000013994
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.