Anti ENOSF1 pAb (ATL-HPA047829 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047829-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: ENOSF1
Alternative Gene Name: HSRTSBETA, rTS, TYMSAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025701: 26%, ENSRNOG00000004268: 25%
Entrez Gene ID: 55556
Uniprot ID: Q7L5Y1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKK |
| Gene Sequence | QHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKK |
| Gene ID - Mouse | ENSMUSG00000025701 |
| Gene ID - Rat | ENSRNOG00000004268 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ENOSF1 pAb (ATL-HPA047829 w/enhanced validation) | |
| Datasheet | Anti ENOSF1 pAb (ATL-HPA047829 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ENOSF1 pAb (ATL-HPA047829 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ENOSF1 pAb (ATL-HPA047829 w/enhanced validation) | |
| Datasheet | Anti ENOSF1 pAb (ATL-HPA047829 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ENOSF1 pAb (ATL-HPA047829 w/enhanced validation) |