Anti ENG pAb (ATL-HPA011862)
Atlas Antibodies
- SKU:
- ATL-HPA011862-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: ENG
Alternative Gene Name: CD105, END, HHT1, ORW, ORW1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026814: 66%, ENSRNOG00000050190: 65%
Entrez Gene ID: 2022
Uniprot ID: P17813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK |
Gene Sequence | ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK |
Gene ID - Mouse | ENSMUSG00000026814 |
Gene ID - Rat | ENSRNOG00000050190 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ENG pAb (ATL-HPA011862) | |
Datasheet | Anti ENG pAb (ATL-HPA011862) Datasheet (External Link) |
Vendor Page | Anti ENG pAb (ATL-HPA011862) at Atlas Antibodies |
Documents & Links for Anti ENG pAb (ATL-HPA011862) | |
Datasheet | Anti ENG pAb (ATL-HPA011862) Datasheet (External Link) |
Vendor Page | Anti ENG pAb (ATL-HPA011862) |
Citations for Anti ENG pAb (ATL-HPA011862) – 1 Found |
Ziebarth, Angela J; Nowsheen, Somaira; Steg, Adam D; Shah, Monjri M; Katre, Ashwini A; Dobbin, Zachary C; Han, Hee-Dong; Lopez-Berestein, Gabriel; Sood, Anil K; Conner, Michael; Yang, Eddy S; Landen, Charles N. Endoglin (CD105) contributes to platinum resistance and is a target for tumor-specific therapy in epithelial ovarian cancer. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2013;19(1):170-82. PubMed |