Anti ENG pAb (ATL-HPA011862)

Atlas Antibodies

SKU:
ATL-HPA011862-25
  • Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.
  • Western blot analysis in human cell line U-138 MG.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: endoglin
Gene Name: ENG
Alternative Gene Name: CD105, END, HHT1, ORW, ORW1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026814: 66%, ENSRNOG00000050190: 65%
Entrez Gene ID: 2022
Uniprot ID: P17813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK
Gene Sequence ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK
Gene ID - Mouse ENSMUSG00000026814
Gene ID - Rat ENSRNOG00000050190
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ENG pAb (ATL-HPA011862)
Datasheet Anti ENG pAb (ATL-HPA011862) Datasheet (External Link)
Vendor Page Anti ENG pAb (ATL-HPA011862) at Atlas Antibodies

Documents & Links for Anti ENG pAb (ATL-HPA011862)
Datasheet Anti ENG pAb (ATL-HPA011862) Datasheet (External Link)
Vendor Page Anti ENG pAb (ATL-HPA011862)



Citations for Anti ENG pAb (ATL-HPA011862) – 1 Found
Ziebarth, Angela J; Nowsheen, Somaira; Steg, Adam D; Shah, Monjri M; Katre, Ashwini A; Dobbin, Zachary C; Han, Hee-Dong; Lopez-Berestein, Gabriel; Sood, Anil K; Conner, Michael; Yang, Eddy S; Landen, Charles N. Endoglin (CD105) contributes to platinum resistance and is a target for tumor-specific therapy in epithelial ovarian cancer. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2013;19(1):170-82.  PubMed