Anti ENDOG pAb (ATL-HPA021830)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021830-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ENDOG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015337: 96%, ENSRNOG00000016033: 96%
Entrez Gene ID: 2021
Uniprot ID: Q14249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRSLTRSYQNVYVCTGPLFLPRTEADGKSYV |
Gene Sequence | YRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRSLTRSYQNVYVCTGPLFLPRTEADGKSYV |
Gene ID - Mouse | ENSMUSG00000015337 |
Gene ID - Rat | ENSRNOG00000016033 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ENDOG pAb (ATL-HPA021830) | |
Datasheet | Anti ENDOG pAb (ATL-HPA021830) Datasheet (External Link) |
Vendor Page | Anti ENDOG pAb (ATL-HPA021830) at Atlas Antibodies |
Documents & Links for Anti ENDOG pAb (ATL-HPA021830) | |
Datasheet | Anti ENDOG pAb (ATL-HPA021830) Datasheet (External Link) |
Vendor Page | Anti ENDOG pAb (ATL-HPA021830) |