Anti ENDOG pAb (ATL-HPA021830)

Atlas Antibodies

Catalog No.:
ATL-HPA021830-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: endonuclease G
Gene Name: ENDOG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015337: 96%, ENSRNOG00000016033: 96%
Entrez Gene ID: 2021
Uniprot ID: Q14249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRSLTRSYQNVYVCTGPLFLPRTEADGKSYV
Gene Sequence YRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRSLTRSYQNVYVCTGPLFLPRTEADGKSYV
Gene ID - Mouse ENSMUSG00000015337
Gene ID - Rat ENSRNOG00000016033
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ENDOG pAb (ATL-HPA021830)
Datasheet Anti ENDOG pAb (ATL-HPA021830) Datasheet (External Link)
Vendor Page Anti ENDOG pAb (ATL-HPA021830) at Atlas Antibodies

Documents & Links for Anti ENDOG pAb (ATL-HPA021830)
Datasheet Anti ENDOG pAb (ATL-HPA021830) Datasheet (External Link)
Vendor Page Anti ENDOG pAb (ATL-HPA021830)