Anti ENAH pAb (ATL-HPA028448 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028448-25

• 
• 
• 

Protein Description: enabled homolog (Drosophila)
Gene Name: ENAH
Alternative Gene Name: FLJ10773, MENA, NDPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022995: 96%, ENSRNOG00000031934: 98%
Entrez Gene ID: 55740
Uniprot ID: Q8N8S7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSN
• Gene Sequence: STSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSN
• Gene ID - Mouse: ENSMUSG00000022995
• Gene ID - Rat: ENSRNOG00000031934
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.