Anti EMSY pAb (ATL-HPA050777)

Atlas Antibodies

SKU:
ATL-HPA050777-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: EMSY, BRCA2 interacting transcriptional repressor
Gene Name: EMSY
Alternative Gene Name: C11orf30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035401: 95%, ENSRNOG00000015560: 95%
Entrez Gene ID: 56946
Uniprot ID: Q7Z589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HTAFTKHSEELGTEEGEVEEMDTLDPQTGLFYRSALTQSQSAKQQKLSQPPLEQTQLQVKTLQCFQTKQKQTIHLQADQLQHKLPQMPQLSIRHQKLTPLQQEQAQPKPDVQHTQHPMVAKDRQLPTLMAQPPQTVVQVLAVKTTQQL
Gene Sequence HTAFTKHSEELGTEEGEVEEMDTLDPQTGLFYRSALTQSQSAKQQKLSQPPLEQTQLQVKTLQCFQTKQKQTIHLQADQLQHKLPQMPQLSIRHQKLTPLQQEQAQPKPDVQHTQHPMVAKDRQLPTLMAQPPQTVVQVLAVKTTQQL
Gene ID - Mouse ENSMUSG00000035401
Gene ID - Rat ENSRNOG00000015560
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EMSY pAb (ATL-HPA050777)
Datasheet Anti EMSY pAb (ATL-HPA050777) Datasheet (External Link)
Vendor Page Anti EMSY pAb (ATL-HPA050777) at Atlas Antibodies

Documents & Links for Anti EMSY pAb (ATL-HPA050777)
Datasheet Anti EMSY pAb (ATL-HPA050777) Datasheet (External Link)
Vendor Page Anti EMSY pAb (ATL-HPA050777)



Citations for Anti EMSY pAb (ATL-HPA050777) – 1 Found
Marzio, Antonio; Kurz, Emma; Sahni, Jennifer M; Di Feo, Giuseppe; Puccini, Joseph; Jiang, Shaowen; Hirsch, Carolina Alcantara; Arbini, Arnaldo A; Wu, Warren L; Pass, Harvey I; Bar-Sagi, Dafna; Papagiannakopoulos, Thales; Pagano, Michele. EMSY inhibits homologous recombination repair and the interferon response, promoting lung cancer immune evasion. Cell. 2022;185(1):169-183.e19.  PubMed