Anti EMP3 pAb (ATL-HPA062030)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062030-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EMP3
Alternative Gene Name: YMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040212: 89%, ENSRNOG00000021104: 89%
Entrez Gene ID: 2014
Uniprot ID: P54852
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGW |
Gene Sequence | WWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGW |
Gene ID - Mouse | ENSMUSG00000040212 |
Gene ID - Rat | ENSRNOG00000021104 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EMP3 pAb (ATL-HPA062030) | |
Datasheet | Anti EMP3 pAb (ATL-HPA062030) Datasheet (External Link) |
Vendor Page | Anti EMP3 pAb (ATL-HPA062030) at Atlas Antibodies |
Documents & Links for Anti EMP3 pAb (ATL-HPA062030) | |
Datasheet | Anti EMP3 pAb (ATL-HPA062030) Datasheet (External Link) |
Vendor Page | Anti EMP3 pAb (ATL-HPA062030) |