Anti EMP3 pAb (ATL-HPA062030)

Atlas Antibodies

Catalog No.:
ATL-HPA062030-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: epithelial membrane protein 3
Gene Name: EMP3
Alternative Gene Name: YMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040212: 89%, ENSRNOG00000021104: 89%
Entrez Gene ID: 2014
Uniprot ID: P54852
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGW
Gene Sequence WWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGW
Gene ID - Mouse ENSMUSG00000040212
Gene ID - Rat ENSRNOG00000021104
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EMP3 pAb (ATL-HPA062030)
Datasheet Anti EMP3 pAb (ATL-HPA062030) Datasheet (External Link)
Vendor Page Anti EMP3 pAb (ATL-HPA062030) at Atlas Antibodies

Documents & Links for Anti EMP3 pAb (ATL-HPA062030)
Datasheet Anti EMP3 pAb (ATL-HPA062030) Datasheet (External Link)
Vendor Page Anti EMP3 pAb (ATL-HPA062030)