Anti EML6 pAb (ATL-HPA062808)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062808-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EML6
Alternative Gene Name: FLJ42562
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044072: 98%, ENSRNOG00000037462: 98%
Entrez Gene ID: 400954
Uniprot ID: Q6ZMW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TNVRWLHNDSVLLTVGGADTALMIWTREFVGTQESKLVDSEESDTDVEEDG |
Gene Sequence | TNVRWLHNDSVLLTVGGADTALMIWTREFVGTQESKLVDSEESDTDVEEDG |
Gene ID - Mouse | ENSMUSG00000044072 |
Gene ID - Rat | ENSRNOG00000037462 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EML6 pAb (ATL-HPA062808) | |
Datasheet | Anti EML6 pAb (ATL-HPA062808) Datasheet (External Link) |
Vendor Page | Anti EML6 pAb (ATL-HPA062808) at Atlas Antibodies |
Documents & Links for Anti EML6 pAb (ATL-HPA062808) | |
Datasheet | Anti EML6 pAb (ATL-HPA062808) Datasheet (External Link) |
Vendor Page | Anti EML6 pAb (ATL-HPA062808) |