Anti EML5 pAb (ATL-HPA054019)

Atlas Antibodies

Catalog No.:
ATL-HPA054019-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: echinoderm microtubule associated protein like 5
Gene Name: EML5
Alternative Gene Name: EMAP-2, HuEMAP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051166: 94%, ENSRNOG00000004207: 96%
Entrez Gene ID: 161436
Uniprot ID: Q05BV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YVPDKLITAGIKHMKFWRKAGGGLIGRKGYIGTLGKNDTMMCAVYGWTEEMAFSGTSTGDVCIWRDIF
Gene Sequence YVPDKLITAGIKHMKFWRKAGGGLIGRKGYIGTLGKNDTMMCAVYGWTEEMAFSGTSTGDVCIWRDIF
Gene ID - Mouse ENSMUSG00000051166
Gene ID - Rat ENSRNOG00000004207
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EML5 pAb (ATL-HPA054019)
Datasheet Anti EML5 pAb (ATL-HPA054019) Datasheet (External Link)
Vendor Page Anti EML5 pAb (ATL-HPA054019) at Atlas Antibodies

Documents & Links for Anti EML5 pAb (ATL-HPA054019)
Datasheet Anti EML5 pAb (ATL-HPA054019) Datasheet (External Link)
Vendor Page Anti EML5 pAb (ATL-HPA054019)