Anti EML5 pAb (ATL-HPA054019)

Atlas Antibodies

Catalog No.: ATL-HPA054019-25

Protein Description: echinoderm microtubule associated protein like 5
Gene Name: EML5
Alternative Gene Name: EMAP-2, HuEMAP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051166: 94%, ENSRNOG00000004207: 96%
Entrez Gene ID: 161436
Uniprot ID: Q05BV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YVPDKLITAGIKHMKFWRKAGGGLIGRKGYIGTLGKNDTMMCAVYGWTEEMAFSGTSTGDVCIWRDIF
• Gene Sequence: YVPDKLITAGIKHMKFWRKAGGGLIGRKGYIGTLGKNDTMMCAVYGWTEEMAFSGTSTGDVCIWRDIF
• Gene ID - Mouse: ENSMUSG00000051166
• Gene ID - Rat: ENSRNOG00000004207
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.