Anti EMILIN3 pAb (ATL-HPA059912)

Atlas Antibodies

SKU: ATL-HPA059912-25

• 

Protein Description: elastin microfibril interfacer 3
Gene Name: EMILIN3
Alternative Gene Name: C20orf130, dJ620E11.4, EMILIN5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050700: 76%, ENSRNOG00000016734: 77%
Entrez Gene ID: 90187
Uniprot ID: Q9NT22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPHGRKGPGLFGERLERLEGDVQRLAQTYGTLSGLVASHEDPNRMTGGPRAPAVPVGFGVIPEGLVGPGDRARGPLTPPLDEILSKVTEVSNTLQT
• Gene Sequence: SPHGRKGPGLFGERLERLEGDVQRLAQTYGTLSGLVASHEDPNRMTGGPRAPAVPVGFGVIPEGLVGPGDRARGPLTPPLDEILSKVTEVSNTLQT
• Gene ID - Mouse: ENSMUSG00000050700
• Gene ID - Rat: ENSRNOG00000016734
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.