Anti EMILIN3 pAb (ATL-HPA059912)

Atlas Antibodies

Catalog No.:
ATL-HPA059912-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: elastin microfibril interfacer 3
Gene Name: EMILIN3
Alternative Gene Name: C20orf130, dJ620E11.4, EMILIN5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050700: 76%, ENSRNOG00000016734: 77%
Entrez Gene ID: 90187
Uniprot ID: Q9NT22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPHGRKGPGLFGERLERLEGDVQRLAQTYGTLSGLVASHEDPNRMTGGPRAPAVPVGFGVIPEGLVGPGDRARGPLTPPLDEILSKVTEVSNTLQT
Gene Sequence SPHGRKGPGLFGERLERLEGDVQRLAQTYGTLSGLVASHEDPNRMTGGPRAPAVPVGFGVIPEGLVGPGDRARGPLTPPLDEILSKVTEVSNTLQT
Gene ID - Mouse ENSMUSG00000050700
Gene ID - Rat ENSRNOG00000016734
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EMILIN3 pAb (ATL-HPA059912)
Datasheet Anti EMILIN3 pAb (ATL-HPA059912) Datasheet (External Link)
Vendor Page Anti EMILIN3 pAb (ATL-HPA059912) at Atlas Antibodies

Documents & Links for Anti EMILIN3 pAb (ATL-HPA059912)
Datasheet Anti EMILIN3 pAb (ATL-HPA059912) Datasheet (External Link)
Vendor Page Anti EMILIN3 pAb (ATL-HPA059912)