Anti EMILIN3 pAb (ATL-HPA059912)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059912-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EMILIN3
Alternative Gene Name: C20orf130, dJ620E11.4, EMILIN5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050700: 76%, ENSRNOG00000016734: 77%
Entrez Gene ID: 90187
Uniprot ID: Q9NT22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SPHGRKGPGLFGERLERLEGDVQRLAQTYGTLSGLVASHEDPNRMTGGPRAPAVPVGFGVIPEGLVGPGDRARGPLTPPLDEILSKVTEVSNTLQT |
| Gene Sequence | SPHGRKGPGLFGERLERLEGDVQRLAQTYGTLSGLVASHEDPNRMTGGPRAPAVPVGFGVIPEGLVGPGDRARGPLTPPLDEILSKVTEVSNTLQT |
| Gene ID - Mouse | ENSMUSG00000050700 |
| Gene ID - Rat | ENSRNOG00000016734 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EMILIN3 pAb (ATL-HPA059912) | |
| Datasheet | Anti EMILIN3 pAb (ATL-HPA059912) Datasheet (External Link) |
| Vendor Page | Anti EMILIN3 pAb (ATL-HPA059912) at Atlas Antibodies |
| Documents & Links for Anti EMILIN3 pAb (ATL-HPA059912) | |
| Datasheet | Anti EMILIN3 pAb (ATL-HPA059912) Datasheet (External Link) |
| Vendor Page | Anti EMILIN3 pAb (ATL-HPA059912) |