Anti EMILIN2 pAb (ATL-HPA064576)

Atlas Antibodies

Catalog No.:
ATL-HPA064576-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: elastin microfibril interfacer 2
Gene Name: EMILIN2
Alternative Gene Name: FLJ33200, FOAP-10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024053: 79%, ENSRNOG00000014837: 81%
Entrez Gene ID: 84034
Uniprot ID: Q9BXX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RMLNGRLDNEFDRLIVPEPDVDFDAKWNELDARINVTEKNAEEHCFYIEETLRGAINGEVGDLKQLVDQKIQSLEDRLGSVLLQMTNNT
Gene Sequence RMLNGRLDNEFDRLIVPEPDVDFDAKWNELDARINVTEKNAEEHCFYIEETLRGAINGEVGDLKQLVDQKIQSLEDRLGSVLLQMTNNT
Gene ID - Mouse ENSMUSG00000024053
Gene ID - Rat ENSRNOG00000014837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EMILIN2 pAb (ATL-HPA064576)
Datasheet Anti EMILIN2 pAb (ATL-HPA064576) Datasheet (External Link)
Vendor Page Anti EMILIN2 pAb (ATL-HPA064576) at Atlas Antibodies

Documents & Links for Anti EMILIN2 pAb (ATL-HPA064576)
Datasheet Anti EMILIN2 pAb (ATL-HPA064576) Datasheet (External Link)
Vendor Page Anti EMILIN2 pAb (ATL-HPA064576)