Anti EMILIN1 pAb (ATL-HPA002822)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002822-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: EMILIN1
Alternative Gene Name: DKFZp586M121, gp115
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029163: 86%, ENSRNOG00000008246: 74%
Entrez Gene ID: 11117
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PQSIMYRRFLRPRYRVAYKTVTDMEWRCCQGYGGDDCAESPAPALGPASSTPRPLARPARPNLSGSSAGSPLSGLGGEGPGESEKVQQLEEQVQSLTKELQGLRGVLQGLSGRLAEDVQRAVETAFNGRQQPADAAARPGVHETLNE |
| Gene Sequence | PQSIMYRRFLRPRYRVAYKTVTDMEWRCCQGYGGDDCAESPAPALGPASSTPRPLARPARPNLSGSSAGSPLSGLGGEGPGESEKVQQLEEQVQSLTKELQGLRGVLQGLSGRLAEDVQRAVETAFNGRQQPADAAARPGVHETLNE |
| Gene ID - Mouse | ENSMUSG00000029163 |
| Gene ID - Rat | ENSRNOG00000008246 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EMILIN1 pAb (ATL-HPA002822) | |
| Datasheet | Anti EMILIN1 pAb (ATL-HPA002822) Datasheet (External Link) |
| Vendor Page | Anti EMILIN1 pAb (ATL-HPA002822) at Atlas Antibodies |
| Documents & Links for Anti EMILIN1 pAb (ATL-HPA002822) | |
| Datasheet | Anti EMILIN1 pAb (ATL-HPA002822) Datasheet (External Link) |
| Vendor Page | Anti EMILIN1 pAb (ATL-HPA002822) |
| Citations for Anti EMILIN1 pAb (ATL-HPA002822) – 3 Found |
| Edlund, Karolina; Lindskog, Cecilia; Saito, Akira; Berglund, Anders; Pontén, Fredrik; Göransson-Kultima, Hanna; Isaksson, Anders; Jirström, Karin; Planck, Maria; Johansson, Leif; Lambe, Mats; Holmberg, Lars; Nyberg, Fredrik; Ekman, Simon; Bergqvist, Michael; Landelius, Per; Lamberg, Kristina; Botling, Johan; Ostman, Arne; Micke, Patrick. CD99 is a novel prognostic stromal marker in non-small cell lung cancer. International Journal Of Cancer. 2012;131(10):2264-73. PubMed |
| Votteler, Miriam; Berrio, Daniel A Carvajal; Horke, Alexander; Sabatier, Laetitia; Reinhardt, Dieter P; Nsair, Ali; Aikawa, Elena; Schenke-Layland, Katja. Elastogenesis at the onset of human cardiac valve development. Development (Cambridge, England). 2013;140(11):2345-53. PubMed |
| Singh, Akaljot; Poling, Holly M; Sundaram, Nambirajan; Brown, Nicole; Wells, James M; Helmrath, Michael A. Evaluation of transplantation sites for human intestinal organoids. Plos One. 15(8):e0237885. PubMed |