Anti EMILIN1 pAb (ATL-HPA002822)

Atlas Antibodies

Catalog No.:
ATL-HPA002822-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: elastin microfibril interfacer 1
Gene Name: EMILIN1
Alternative Gene Name: DKFZp586M121, gp115
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029163: 86%, ENSRNOG00000008246: 74%
Entrez Gene ID: 11117
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQSIMYRRFLRPRYRVAYKTVTDMEWRCCQGYGGDDCAESPAPALGPASSTPRPLARPARPNLSGSSAGSPLSGLGGEGPGESEKVQQLEEQVQSLTKELQGLRGVLQGLSGRLAEDVQRAVETAFNGRQQPADAAARPGVHETLNE
Gene Sequence PQSIMYRRFLRPRYRVAYKTVTDMEWRCCQGYGGDDCAESPAPALGPASSTPRPLARPARPNLSGSSAGSPLSGLGGEGPGESEKVQQLEEQVQSLTKELQGLRGVLQGLSGRLAEDVQRAVETAFNGRQQPADAAARPGVHETLNE
Gene ID - Mouse ENSMUSG00000029163
Gene ID - Rat ENSRNOG00000008246
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EMILIN1 pAb (ATL-HPA002822)
Datasheet Anti EMILIN1 pAb (ATL-HPA002822) Datasheet (External Link)
Vendor Page Anti EMILIN1 pAb (ATL-HPA002822) at Atlas Antibodies

Documents & Links for Anti EMILIN1 pAb (ATL-HPA002822)
Datasheet Anti EMILIN1 pAb (ATL-HPA002822) Datasheet (External Link)
Vendor Page Anti EMILIN1 pAb (ATL-HPA002822)
Citations for Anti EMILIN1 pAb (ATL-HPA002822) – 3 Found
Edlund, Karolina; Lindskog, Cecilia; Saito, Akira; Berglund, Anders; Pontén, Fredrik; Göransson-Kultima, Hanna; Isaksson, Anders; Jirström, Karin; Planck, Maria; Johansson, Leif; Lambe, Mats; Holmberg, Lars; Nyberg, Fredrik; Ekman, Simon; Bergqvist, Michael; Landelius, Per; Lamberg, Kristina; Botling, Johan; Ostman, Arne; Micke, Patrick. CD99 is a novel prognostic stromal marker in non-small cell lung cancer. International Journal Of Cancer. 2012;131(10):2264-73.  PubMed
Votteler, Miriam; Berrio, Daniel A Carvajal; Horke, Alexander; Sabatier, Laetitia; Reinhardt, Dieter P; Nsair, Ali; Aikawa, Elena; Schenke-Layland, Katja. Elastogenesis at the onset of human cardiac valve development. Development (Cambridge, England). 2013;140(11):2345-53.  PubMed
Singh, Akaljot; Poling, Holly M; Sundaram, Nambirajan; Brown, Nicole; Wells, James M; Helmrath, Michael A. Evaluation of transplantation sites for human intestinal organoids. Plos One. 15(8):e0237885.  PubMed