Anti EMC8 pAb (ATL-HPA049476)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049476-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EMC8
Alternative Gene Name: C16orf2, C16orf4, COX4NB, FAM158B, NOC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031819: 83%, ENSRNOG00000017654: 83%
Entrez Gene ID: 10328
Uniprot ID: O43402
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVD |
Gene Sequence | VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVD |
Gene ID - Mouse | ENSMUSG00000031819 |
Gene ID - Rat | ENSRNOG00000017654 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EMC8 pAb (ATL-HPA049476) | |
Datasheet | Anti EMC8 pAb (ATL-HPA049476) Datasheet (External Link) |
Vendor Page | Anti EMC8 pAb (ATL-HPA049476) at Atlas Antibodies |
Documents & Links for Anti EMC8 pAb (ATL-HPA049476) | |
Datasheet | Anti EMC8 pAb (ATL-HPA049476) Datasheet (External Link) |
Vendor Page | Anti EMC8 pAb (ATL-HPA049476) |