Anti EMC8 pAb (ATL-HPA049476)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049476-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: EMC8
Alternative Gene Name: C16orf2, C16orf4, COX4NB, FAM158B, NOC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031819: 83%, ENSRNOG00000017654: 83%
Entrez Gene ID: 10328
Uniprot ID: O43402
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVD |
| Gene Sequence | VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVD |
| Gene ID - Mouse | ENSMUSG00000031819 |
| Gene ID - Rat | ENSRNOG00000017654 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EMC8 pAb (ATL-HPA049476) | |
| Datasheet | Anti EMC8 pAb (ATL-HPA049476) Datasheet (External Link) |
| Vendor Page | Anti EMC8 pAb (ATL-HPA049476) at Atlas Antibodies |
| Documents & Links for Anti EMC8 pAb (ATL-HPA049476) | |
| Datasheet | Anti EMC8 pAb (ATL-HPA049476) Datasheet (External Link) |
| Vendor Page | Anti EMC8 pAb (ATL-HPA049476) |