Anti EMC2 pAb (ATL-HPA022838)

Atlas Antibodies

SKU:
ATL-HPA022838-100
  • Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ER membrane protein complex subunit 2
Gene Name: EMC2
Alternative Gene Name: KIAA0103, TTC35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022337: 96%, ENSRNOG00000005123: 73%
Entrez Gene ID: 9694
Uniprot ID: Q15006
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSH
Gene Sequence ELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSH
Gene ID - Mouse ENSMUSG00000022337
Gene ID - Rat ENSRNOG00000005123
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EMC2 pAb (ATL-HPA022838)
Datasheet Anti EMC2 pAb (ATL-HPA022838) Datasheet (External Link)
Vendor Page Anti EMC2 pAb (ATL-HPA022838) at Atlas Antibodies

Documents & Links for Anti EMC2 pAb (ATL-HPA022838)
Datasheet Anti EMC2 pAb (ATL-HPA022838) Datasheet (External Link)
Vendor Page Anti EMC2 pAb (ATL-HPA022838)