Anti EMC1 pAb (ATL-HPA048904)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048904-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EMC1
Alternative Gene Name: KIAA0090
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078517: 93%, ENSRNOG00000018097: 93%
Entrez Gene ID: 23065
Uniprot ID: Q8N766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTL |
Gene Sequence | LKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTL |
Gene ID - Mouse | ENSMUSG00000078517 |
Gene ID - Rat | ENSRNOG00000018097 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EMC1 pAb (ATL-HPA048904) | |
Datasheet | Anti EMC1 pAb (ATL-HPA048904) Datasheet (External Link) |
Vendor Page | Anti EMC1 pAb (ATL-HPA048904) at Atlas Antibodies |
Documents & Links for Anti EMC1 pAb (ATL-HPA048904) | |
Datasheet | Anti EMC1 pAb (ATL-HPA048904) Datasheet (External Link) |
Vendor Page | Anti EMC1 pAb (ATL-HPA048904) |