Anti EMC1 pAb (ATL-HPA048904)

Atlas Antibodies

Catalog No.:
ATL-HPA048904-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ER membrane protein complex subunit 1
Gene Name: EMC1
Alternative Gene Name: KIAA0090
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078517: 93%, ENSRNOG00000018097: 93%
Entrez Gene ID: 23065
Uniprot ID: Q8N766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTL
Gene Sequence LKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTL
Gene ID - Mouse ENSMUSG00000078517
Gene ID - Rat ENSRNOG00000018097
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EMC1 pAb (ATL-HPA048904)
Datasheet Anti EMC1 pAb (ATL-HPA048904) Datasheet (External Link)
Vendor Page Anti EMC1 pAb (ATL-HPA048904) at Atlas Antibodies

Documents & Links for Anti EMC1 pAb (ATL-HPA048904)
Datasheet Anti EMC1 pAb (ATL-HPA048904) Datasheet (External Link)
Vendor Page Anti EMC1 pAb (ATL-HPA048904)