Anti ELOF1 pAb (ATL-HPA045606)

Atlas Antibodies

Catalog No.: ATL-HPA045606-25

Protein Description: elongation factor 1 homolog (S. cerevisiae)
Gene Name: ELOF1
Alternative Gene Name: ELF1, MGC4549
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013822: 100%, ENSRNOG00000014284: 100%
Entrez Gene ID: 84337
Uniprot ID: P60002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDW
• Gene Sequence: KMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDW
• Gene ID - Mouse: ENSMUSG00000013822
• Gene ID - Rat: ENSRNOG00000014284
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.