Anti ELOF1 pAb (ATL-HPA045606)

Atlas Antibodies

Catalog No.:
ATL-HPA045606-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: elongation factor 1 homolog (S. cerevisiae)
Gene Name: ELOF1
Alternative Gene Name: ELF1, MGC4549
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013822: 100%, ENSRNOG00000014284: 100%
Entrez Gene ID: 84337
Uniprot ID: P60002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDW
Gene Sequence KMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDW
Gene ID - Mouse ENSMUSG00000013822
Gene ID - Rat ENSRNOG00000014284
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELOF1 pAb (ATL-HPA045606)
Datasheet Anti ELOF1 pAb (ATL-HPA045606) Datasheet (External Link)
Vendor Page Anti ELOF1 pAb (ATL-HPA045606) at Atlas Antibodies

Documents & Links for Anti ELOF1 pAb (ATL-HPA045606)
Datasheet Anti ELOF1 pAb (ATL-HPA045606) Datasheet (External Link)
Vendor Page Anti ELOF1 pAb (ATL-HPA045606)