Anti ELOF1 pAb (ATL-HPA045606)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045606-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ELOF1
Alternative Gene Name: ELF1, MGC4549
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013822: 100%, ENSRNOG00000014284: 100%
Entrez Gene ID: 84337
Uniprot ID: P60002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDW |
Gene Sequence | KMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDW |
Gene ID - Mouse | ENSMUSG00000013822 |
Gene ID - Rat | ENSRNOG00000014284 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ELOF1 pAb (ATL-HPA045606) | |
Datasheet | Anti ELOF1 pAb (ATL-HPA045606) Datasheet (External Link) |
Vendor Page | Anti ELOF1 pAb (ATL-HPA045606) at Atlas Antibodies |
Documents & Links for Anti ELOF1 pAb (ATL-HPA045606) | |
Datasheet | Anti ELOF1 pAb (ATL-HPA045606) Datasheet (External Link) |
Vendor Page | Anti ELOF1 pAb (ATL-HPA045606) |