Anti ELOC pAb (ATL-HPA078113)
Atlas Antibodies
- Catalog No.:
- ATL-HPA078113-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ELOC
Alternative Gene Name: SIII, TCEB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079658: 100%, ENSRNOG00000031730: 100%
Entrez Gene ID: 6921
Uniprot ID: Q15369
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI |
Gene Sequence | ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI |
Gene ID - Mouse | ENSMUSG00000079658 |
Gene ID - Rat | ENSRNOG00000031730 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ELOC pAb (ATL-HPA078113) | |
Datasheet | Anti ELOC pAb (ATL-HPA078113) Datasheet (External Link) |
Vendor Page | Anti ELOC pAb (ATL-HPA078113) at Atlas Antibodies |
Documents & Links for Anti ELOC pAb (ATL-HPA078113) | |
Datasheet | Anti ELOC pAb (ATL-HPA078113) Datasheet (External Link) |
Vendor Page | Anti ELOC pAb (ATL-HPA078113) |