Anti ELOB pAb (ATL-HPA064006)

Atlas Antibodies

SKU:
ATL-HPA064006-25
  • Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: elongin B
Gene Name: ELOB
Alternative Gene Name: SIII, TCEB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055839: 98%, ENSRNOG00000004814: 98%
Entrez Gene ID: 6923
Uniprot ID: Q15370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSS
Gene Sequence FTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSS
Gene ID - Mouse ENSMUSG00000055839
Gene ID - Rat ENSRNOG00000004814
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ELOB pAb (ATL-HPA064006)
Datasheet Anti ELOB pAb (ATL-HPA064006) Datasheet (External Link)
Vendor Page Anti ELOB pAb (ATL-HPA064006) at Atlas Antibodies

Documents & Links for Anti ELOB pAb (ATL-HPA064006)
Datasheet Anti ELOB pAb (ATL-HPA064006) Datasheet (External Link)
Vendor Page Anti ELOB pAb (ATL-HPA064006)