Anti ELOB pAb (ATL-HPA064006)
Atlas Antibodies
- SKU:
- ATL-HPA064006-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ELOB
Alternative Gene Name: SIII, TCEB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055839: 98%, ENSRNOG00000004814: 98%
Entrez Gene ID: 6923
Uniprot ID: Q15370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSS |
Gene Sequence | FTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSS |
Gene ID - Mouse | ENSMUSG00000055839 |
Gene ID - Rat | ENSRNOG00000004814 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ELOB pAb (ATL-HPA064006) | |
Datasheet | Anti ELOB pAb (ATL-HPA064006) Datasheet (External Link) |
Vendor Page | Anti ELOB pAb (ATL-HPA064006) at Atlas Antibodies |
Documents & Links for Anti ELOB pAb (ATL-HPA064006) | |
Datasheet | Anti ELOB pAb (ATL-HPA064006) Datasheet (External Link) |
Vendor Page | Anti ELOB pAb (ATL-HPA064006) |