Anti ELN pAb (ATL-HPA056941)

Atlas Antibodies

SKU:
ATL-HPA056941-25
  • Immunohistochemical staining of human lung shows moderate positivity in the extracellular matrix in blood vessels.
  • Immunofluorescent staining of human cell line BJ shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: elastin
Gene Name: ELN
Alternative Gene Name: SVAS, WBS, WS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029675: 57%, ENSRNOG00000001469: 56%
Entrez Gene ID: 2006
Uniprot ID: P15502
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGGLGVPGVGGLGGIPPAAAAKAAKYGAAGLGGVLGGAGQFPLGGVAARPGFGLSPIFPGGACLGKACGRKR
Gene Sequence VGGLGVPGVGGLGGIPPAAAAKAAKYGAAGLGGVLGGAGQFPLGGVAARPGFGLSPIFPGGACLGKACGRKR
Gene ID - Mouse ENSMUSG00000029675
Gene ID - Rat ENSRNOG00000001469
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ELN pAb (ATL-HPA056941)
Datasheet Anti ELN pAb (ATL-HPA056941) Datasheet (External Link)
Vendor Page Anti ELN pAb (ATL-HPA056941) at Atlas Antibodies

Documents & Links for Anti ELN pAb (ATL-HPA056941)
Datasheet Anti ELN pAb (ATL-HPA056941) Datasheet (External Link)
Vendor Page Anti ELN pAb (ATL-HPA056941)