Anti ELN pAb (ATL-HPA018111)

Atlas Antibodies

Catalog No.: ATL-HPA018111-25

Protein Description: elastin
Gene Name: ELN
Alternative Gene Name: SVAS, WBS, WS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029675: 85%, ENSRNOG00000001469: 83%
Entrez Gene ID: 2006
Uniprot ID: P15502
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGA
• Gene Sequence: VKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGA
• Gene ID - Mouse: ENSMUSG00000029675
• Gene ID - Rat: ENSRNOG00000001469
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ELN pAb (ATL-HPA018111) – 3 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Votteler, Miriam; Berrio, Daniel A Carvajal; Horke, Alexander; Sabatier, Laetitia; Reinhardt, Dieter P; Nsair, Ali; Aikawa, Elena; Schenke-Layland, Katja. Elastogenesis at the onset of human cardiac valve development. Development (Cambridge, England). 2013;140(11):2345-53. 

Sun, Qinxue; Baues, Maike; Klinkhammer, Barbara M; Ehling, Josef; Djudjaj, Sonja; Drude, Natascha I; Daniel, Christoph; Amann, Kerstin; Kramann, Rafael; Kim, Hyojin; Saez-Rodriguez, Julio; Weiskirchen, Ralf; Onthank, David C; Botnar, Rene M; Kiessling, Fabian; Floege, Jürgen; Lammers, Twan; Boor, Peter. Elastin imaging enables noninvasive staging and treatment monitoring of kidney fibrosis. Science Translational Medicine. 2019;11(486)