Anti ELMOD1 pAb (ATL-HPA038434 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038434-25

• 
• 

Protein Description: ELMO/CED-12 domain containing 1
Gene Name: ELMOD1
Alternative Gene Name: DKFZp547C176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041986: 100%, ENSRNOG00000009054: 100%
Entrez Gene ID: 55531
Uniprot ID: Q8N336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: THFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
• Gene Sequence: THFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
• Gene ID - Mouse: ENSMUSG00000041986
• Gene ID - Rat: ENSRNOG00000009054
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.