Anti ELMOD1 pAb (ATL-HPA038434 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA038434-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ELMOD1
Alternative Gene Name: DKFZp547C176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041986: 100%, ENSRNOG00000009054: 100%
Entrez Gene ID: 55531
Uniprot ID: Q8N336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | THFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM |
Gene Sequence | THFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM |
Gene ID - Mouse | ENSMUSG00000041986 |
Gene ID - Rat | ENSRNOG00000009054 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ELMOD1 pAb (ATL-HPA038434 w/enhanced validation) | |
Datasheet | Anti ELMOD1 pAb (ATL-HPA038434 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ELMOD1 pAb (ATL-HPA038434 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ELMOD1 pAb (ATL-HPA038434 w/enhanced validation) | |
Datasheet | Anti ELMOD1 pAb (ATL-HPA038434 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ELMOD1 pAb (ATL-HPA038434 w/enhanced validation) |