Anti ELFN2 pAb (ATL-HPA000781)

Atlas Antibodies

Catalog No.:
ATL-HPA000781-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: extracellular leucine-rich repeat and fibronectin type III domain containing 2
Gene Name: ELFN2
Alternative Gene Name: dJ63G5.3, KIAA1904, LRRC62, PPP1R29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043460: 100%, ENSRNOG00000007934: 99%
Entrez Gene ID: 114794
Uniprot ID: Q5R3F8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK
Gene Sequence GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK
Gene ID - Mouse ENSMUSG00000043460
Gene ID - Rat ENSRNOG00000007934
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELFN2 pAb (ATL-HPA000781)
Datasheet Anti ELFN2 pAb (ATL-HPA000781) Datasheet (External Link)
Vendor Page Anti ELFN2 pAb (ATL-HPA000781) at Atlas Antibodies

Documents & Links for Anti ELFN2 pAb (ATL-HPA000781)
Datasheet Anti ELFN2 pAb (ATL-HPA000781) Datasheet (External Link)
Vendor Page Anti ELFN2 pAb (ATL-HPA000781)
Citations for Anti ELFN2 pAb (ATL-HPA000781) – 6 Found
Szoboszlay, Miklos; Kirizs, Tekla; Nusser, Zoltan. Objective quantification of nanoscale protein distributions. Scientific Reports. 2017;7(1):15240.  PubMed
Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22.  PubMed
Dolan, Jackie; Mitchell, Kevin J. Mutation of Elfn1 in mice causes seizures and hyperactivity. Plos One. 8(11):e80491.  PubMed
Stachniak, Tevye Jason; Sylwestrak, Emily Lauren; Scheiffele, Peter; Hall, Benjamin J; Ghosh, Anirvan. Elfn1-Induced Constitutive Activation of mGluR7 Determines Frequency-Dependent Recruitment of Somatostatin Interneurons. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2019;39(23):4461-4474.  PubMed
Dunn, Henry A; Zucca, Stefano; Dao, Maria; Orlandi, Cesare; Martemyanov, Kirill A. ELFN2 is a postsynaptic cell adhesion molecule with essential roles in controlling group III mGluRs in the brain and neuropsychiatric behavior. Molecular Psychiatry. 2019;24(12):1902-1919.  PubMed
Holderith, Noemi; Aldahabi, Mohammad; Nusser, Zoltan. Selective Enrichment of Munc13-2 in Presynaptic Active Zones of Hippocampal Pyramidal Cells That Innervate mGluR1α Expressing Interneurons. Frontiers In Synaptic Neuroscience. 13( 35221979):773209.  PubMed