Anti ELF4 pAb (ATL-HPA060277)

Atlas Antibodies

Catalog No.:
ATL-HPA060277-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: E74-like factor 4 (ets domain transcription factor)
Gene Name: ELF4
Alternative Gene Name: ELFR, MEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031103: 52%, ENSRNOG00000005352: 53%
Entrez Gene ID: 2000
Uniprot ID: Q99607
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDDNEATSHTMSTAEVLLNMESPSDILDEKQIFSTSEMLPDSDPAPAVTLPNYLFPASEPDALNRAGDTSDQEGHSLEEKASREESAKKT
Gene Sequence TDDNEATSHTMSTAEVLLNMESPSDILDEKQIFSTSEMLPDSDPAPAVTLPNYLFPASEPDALNRAGDTSDQEGHSLEEKASREESAKKT
Gene ID - Mouse ENSMUSG00000031103
Gene ID - Rat ENSRNOG00000005352
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELF4 pAb (ATL-HPA060277)
Datasheet Anti ELF4 pAb (ATL-HPA060277) Datasheet (External Link)
Vendor Page Anti ELF4 pAb (ATL-HPA060277) at Atlas Antibodies

Documents & Links for Anti ELF4 pAb (ATL-HPA060277)
Datasheet Anti ELF4 pAb (ATL-HPA060277) Datasheet (External Link)
Vendor Page Anti ELF4 pAb (ATL-HPA060277)